Lineage for d4qqwc2 (4qqw C:260-547)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870651Protein CRISPR-associated protein Cas3 [419203] (1 species)
    second domain includes C-terminal linker region
  7. 2870652Species Thermobifida fusca [TaxId:269800] [419716] (3 PDB entries)
  8. 2870655Domain d4qqwc2: 4qqw C:260-547 [414179]
    Other proteins in same PDB: d4qqwa1, d4qqwa4, d4qqwc1, d4qqwc4, d4qqwe1, d4qqwe4, d4qqwg1, d4qqwg4
    automated match to d4qqwa2
    protein/DNA complex; complexed with fe

Details for d4qqwc2

PDB Entry: 4qqw (more details), 2.66 Å

PDB Description: Crystal structure of T. fusca Cas3
PDB Compounds: (C:) CRISPR-associated helicase, Cas3 family

SCOPe Domain Sequences for d4qqwc2:

Sequence, based on SEQRES records: (download)

>d4qqwc2 c.37.1.19 (C:260-547) CRISPR-associated protein Cas3 {Thermobifida fusca [TaxId: 269800]}
lrpitvppatftesfphlskpnglqaslakhlpclctgpglvlitapmgegkteaayhva
dllgkatgrpgrflalptmatadqmhtrlkeyaryrventdlprsstlallhsmawlnpd
yapadlpgvskvlsnlghrdpfaatdwlmgrkrgllapwavgtidqalmavlrakhnalr
lfglagkvvvvdeahavdpymqvlleqllrwlgtldvpvvllsatlhhsianslvkayle
gargrrwnrsepqpvsevsypgwlhvdarigkvtrssdvdplpiattp

Sequence, based on observed residues (ATOM records): (download)

>d4qqwc2 c.37.1.19 (C:260-547) CRISPR-associated protein Cas3 {Thermobifida fusca [TaxId: 269800]}
lrpitvppatftesfphlskpnglqaslakhlpclctgpglvlitapmgegkteaayhva
dllgkatgrpgrflalptmatadqmhtrlkeyaryrventrsstlallhsmawlnpdyap
adpfaatdwlmgrkrgllapwavgtidqalmavlrakhnalrlfglagkvvvvdeahavd
pymqvlleqllrwlgtldvpvvllsatlhhsianslvkaylegargrrwnrsepqpvsev
sypgwlhvdarigkvtrssdvdplpiattp

SCOPe Domain Coordinates for d4qqwc2:

Click to download the PDB-style file with coordinates for d4qqwc2.
(The format of our PDB-style files is described here.)

Timeline for d4qqwc2:

  • d4qqwc2 is new in SCOPe 2.08-stable