| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
| Family a.211.1.7: HD domain from Cas3-like [418854] (1 protein) Pfam PF12252 |
| Protein CRISPR-associated protein Cas3 [419201] (1 species) |
| Species Thermobifida fusca [TaxId:269800] [419713] (3 PDB entries) |
| Domain d4qqwc1: 4qqw C:14-259 [414178] Other proteins in same PDB: d4qqwa2, d4qqwa3, d4qqwa4, d4qqwc2, d4qqwc3, d4qqwc4, d4qqwe2, d4qqwe3, d4qqwe4, d4qqwg2, d4qqwg3, d4qqwg4 automated match to d4qqwa1 protein/DNA complex; complexed with fe |
PDB Entry: 4qqw (more details), 2.66 Å
SCOPe Domain Sequences for d4qqwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qqwc1 a.211.1.7 (C:14-259) CRISPR-associated protein Cas3 {Thermobifida fusca [TaxId: 269800]}
ppldlrfwakerglrgktyplvchsldaaaaalvlwneylspglrdtiassmetdeehag
hciafwaglhdigkltrefqqqiaidlsaypgeelsgeqrshaaatgkwlpfalpslgyp
ngglvtglvaqmlgghhgtfhphpsfqsrnplaefgfssphwekqrhallhavfdatgrp
tppdmldgptasvvcglviladwlvsqedfllerltslpadgsasalrahfetslrrips
lldaag
Timeline for d4qqwc1: