Lineage for d2bccb_ (2bcc B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35957Fold d.132: Mitochondrial processing peptidase, MPP [55993] (1 superfamily)
  4. 35958Superfamily d.132.1: Mitochondrial processing peptidase, MPP [55994] (1 family) (S)
  5. 35959Family d.132.1.1: Cytochrome bc1 core subunits [55995] (2 proteins)
  6. 35970Protein Core 2 subunit [55999] (2 species)
  7. 35971Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries)
  8. 35973Domain d2bccb_: 2bcc B: [41412]
    Other proteins in same PDB: d2bcca_, d2bccc1, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf1, d2bccg1, d2bcch1, d2bccj1

Details for d2bccb_

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bccb_:

Sequence, based on SEQRES records: (download)

>d2bccb_ d.132.1.1 (B:) Core 2 subunit {Chicken (Gallus gallus)}
pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
hftsarmalvglgvshpvlknvaeqllnirgglglsgakakyrggeireqngdslvhaai
vaesaaiggaeanafsvlqhvlganphvkrglnatsslyqavakgvhqpfdvsafnasys
dsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylmsvesseg
fleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlghtpfvd
el

Sequence, based on observed residues (ATOM records): (download)

>d2bccb_ d.132.1.1 (B:) Core 2 subunit {Chicken (Gallus gallus)}
pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
hftsarmalvglgvshpvlknvaeqllnirgglglsgakakyrggeireqngdslvhaai
vaesaaiggaeanafsvlqhvlganphvkrgnpfdvsafnasysdsglfgfytisqaaya
gqvikaaynqvktiaqgnvsnenvqaaknklkakylmsvessegfleevgsqalaagsyn
ppstvlqqidavadadvikaakkfvsrqksmaasgnlghtpfvdel

SCOP Domain Coordinates for d2bccb_:

Click to download the PDB-style file with coordinates for d2bccb_.
(The format of our PDB-style files is described here.)

Timeline for d2bccb_: