Lineage for d1bgyb_ (1bgy B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35957Fold d.132: Mitochondrial processing peptidase, MPP [55993] (1 superfamily)
  4. 35958Superfamily d.132.1: Mitochondrial processing peptidase, MPP [55994] (1 family) (S)
  5. 35959Family d.132.1.1: Cytochrome bc1 core subunits [55995] (2 proteins)
  6. 35970Protein Core 2 subunit [55999] (2 species)
  7. 35975Species Cow (Bos taurus) [TaxId:9913] [56000] (3 PDB entries)
  8. 35978Domain d1bgyb_: 1bgy B: [41409]
    Other proteins in same PDB: d1bgya_, d1bgyc1, d1bgyd2, d1bgyd3, d1bgye1, d1bgyf1, d1bgyg1, d1bgyh1, d1bgyj1, d1bgyk1, d1bgym_, d1bgyo1, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr1, d1bgys1, d1bgyt1, d1bgyv1, d1bgyw1

Details for d1bgyb_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyb_ d.132.1.1 (B:) Core 2 subunit {Cow (Bos taurus)}
pqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkga
ssfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaal
qpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhft
sarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaalvae
saaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasysdsg
lfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvessegfld
evgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfidel

SCOP Domain Coordinates for d1bgyb_:

Click to download the PDB-style file with coordinates for d1bgyb_.
(The format of our PDB-style files is described here.)

Timeline for d1bgyb_: