Lineage for d1be3b_ (1be3 B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35957Fold d.132: Mitochondrial processing peptidase, MPP [55993] (1 superfamily)
  4. 35958Superfamily d.132.1: Mitochondrial processing peptidase, MPP [55994] (1 family) (S)
  5. 35959Family d.132.1.1: Cytochrome bc1 core subunits [55995] (2 proteins)
  6. 35970Protein Core 2 subunit [55999] (2 species)
  7. 35975Species Cow (Bos taurus) [TaxId:9913] [56000] (3 PDB entries)
  8. 35976Domain d1be3b_: 1be3 B: [41407]
    Other proteins in same PDB: d1be3a_, d1be3c1, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f1, d1be3g1, d1be3h1, d1be3j1, d1be3k1

Details for d1be3b_

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3b_ d.132.1.1 (B:) Core 2 subunit {Cow (Bos taurus)}
pqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkga
ssfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaal
qpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhft
sarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaalvae
saaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasysdsg
lfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvessegfld
evgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfidel

SCOP Domain Coordinates for d1be3b_:

Click to download the PDB-style file with coordinates for d1be3b_.
(The format of our PDB-style files is described here.)

Timeline for d1be3b_: