Lineage for d1bcca_ (1bcc A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35957Fold d.132: Mitochondrial processing peptidase, MPP [55993] (1 superfamily)
  4. 35958Superfamily d.132.1: Mitochondrial processing peptidase, MPP [55994] (1 family) (S)
  5. 35959Family d.132.1.1: Cytochrome bc1 core subunits [55995] (2 proteins)
  6. 35960Protein Core 1 subunit [55996] (2 species)
  7. 35961Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries)
  8. 35962Domain d1bcca_: 1bcc A: [41404]
    Other proteins in same PDB: d1bccb_, d1bccc1, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf1, d1bccg1, d1bcch1, d1bccj1

Details for d1bcca_

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

SCOP Domain Sequences for d1bcca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcca_ d.132.1.1 (A:) Core 1 subunit {Chicken (Gallus gallus)}
yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla
fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle
dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt
eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptlskcrftgsqirh
redglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsssplasiavtnkl
cqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsisesevlrgknflrn
alvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcskyiydqcpava
gpgpieqlpdynrirsgmfwlr

SCOP Domain Coordinates for d1bcca_:

Click to download the PDB-style file with coordinates for d1bcca_.
(The format of our PDB-style files is described here.)

Timeline for d1bcca_: