Lineage for d1qcra_ (1qcr A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35957Fold d.132: Mitochondrial processing peptidase, MPP [55993] (1 superfamily)
  4. 35958Superfamily d.132.1: Mitochondrial processing peptidase, MPP [55994] (1 family) (S)
  5. 35959Family d.132.1.1: Cytochrome bc1 core subunits [55995] (2 proteins)
  6. 35960Protein Core 1 subunit [55996] (2 species)
  7. 35965Species Cow (Bos taurus) [TaxId:9913] [55997] (3 PDB entries)
  8. 35967Domain d1qcra_: 1qcr A: [41401]
    Other proteins in same PDB: d1qcrb_, d1qcrc1, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf1, d1qcrg1, d1qcrh1, d1qcrj1, d1qcrk1

Details for d1qcra_

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcra_ d.132.1.1 (A:) Core 1 subunit {Cow (Bos taurus)}
tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
avagfgpveqlpdynrirsgmfwlrf

SCOP Domain Coordinates for d1qcra_:

Click to download the PDB-style file with coordinates for d1qcra_.
(The format of our PDB-style files is described here.)

Timeline for d1qcra_: