Lineage for d1axcc1 (1axc C:1-126)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2215978Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2216000Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2216043Species Human (Homo sapiens) [TaxId:9606] [55991] (9 PDB entries)
    Uniprot P12004
  8. 2216056Domain d1axcc1: 1axc C:1-126 [41394]
    protein/DNA complex

Details for d1axcc1

PDB Entry: 1axc (more details), 2.6 Å

PDB Description: human pcna
PDB Compounds: (C:) pcna

SCOPe Domain Sequences for d1axcc1:

Sequence, based on SEQRES records: (download)

>d1axcc1 d.131.1.2 (C:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

Sequence, based on observed residues (ATOM records): (download)

>d1axcc1 d.131.1.2 (C:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapekvsdyemklmdld
veql

SCOPe Domain Coordinates for d1axcc1:

Click to download the PDB-style file with coordinates for d1axcc1.
(The format of our PDB-style files is described here.)

Timeline for d1axcc1: