SCOPe 2.08: Domain d4d2nd1: 4d2n D:235-339

Lineage for d4d2nd1 (4d2n D:235-339)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d4d2nd1: 4d2n D:235-339 [413741]
automated match to d1hzhh3
complexed with gol

Details for d4d2nd1

PDB Entry: 4d2n (more details), 2.7 Å

PDB Description: crystal structure of deglycosylated serum-derived human igg4 fc

PDB Compounds: (D:) ig gamma-4 chain c region

SCOPe Domain Sequences for d4d2nd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d2nd1 b.1.1.2 (D:235-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggpsvflfppkpkdtlmisrtpevtcvvvdvsqedpevqfnwyvdgvevhnaktkpree
qfdstyrvvsvltvlhqdwlngkeykckvsnkglpssiektiska

SCOPe Domain Coordinates for d4d2nd1:

Click to download the PDB-style file with coordinates for d4d2nd1.
(The format of our PDB-style files is described here.)

Timeline for d4d2nd1: