SCOPe 2.08: Domain d1qm4a2: 1qm4 A:129-252

Lineage for d1qm4a2 (1qm4 A:129-252)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)

6. Protein S-adenosylmethionine synthetase [55975] (3 species)
   synonym: methionine adenosyltransferase, MAT

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55977] (5 PDB entries)

8. Domain d1qm4a2: 1qm4 A:129-252 [41351]
   complexed with amb, k, mg, so4

Details for d1qm4a2

PDB Entry: 1qm4, 2.66 Å

PDB Description: methionine adenosyltransferase complexed with a l-methionine analogue

PDB Compounds: (A:) methionine adenosyltransferase, alpha form

SCOPe Domain Sequences for d1qm4a2:

Sequence; same for both SEQRES and ATOM records:

>d1qm4a2 d.130.1.1 (A:129-252) S-adenosylmethionine synthetase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
edvgagdqglmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvq
yvqdngavipvrvhtivisvqhneditleamrealkeqvikavvpakyldedtiyhlqps
grfv

Timeline for d1qm4a2:

• d1qm4a2 first appeared (with stable ids) in SCOP 1.55
  
• d1qm4a2 appears in SCOPe 2.07