Lineage for d1ndoe2 (1ndo E:155-445)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510905Fold d.129: TBP-like [55944] (8 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 511069Superfamily d.129.3: Bet v1-like [55961] (5 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 511112Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain (Pfam 00848) [55969] (2 proteins)
    contains a few insertion and C-terminal extension compared with Bet v1
  6. 511121Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (1 species)
  7. 511122Species Pseudomonas putida [TaxId:303] [55971] (8 PDB entries)
  8. 511132Domain d1ndoe2: 1ndo E:155-445 [41325]
    Other proteins in same PDB: d1ndoa1, d1ndob_, d1ndoc1, d1ndod_, d1ndoe1, d1ndof_

Details for d1ndoe2

PDB Entry: 1ndo (more details), 2.25 Å

PDB Description: napthalene 1,2-dioxygenase

SCOP Domain Sequences for d1ndoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndoe2 d.129.3.3 (E:155-445) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltk

SCOP Domain Coordinates for d1ndoe2:

Click to download the PDB-style file with coordinates for d1ndoe2.
(The format of our PDB-style files is described here.)

Timeline for d1ndoe2: