Lineage for d1ndoc2 (1ndo C:155-447)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418216Fold d.129: TBP-like [55944] (7 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 418378Superfamily d.129.3: Bet v1-like [55961] (4 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 418421Family d.129.3.3: Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55969] (1 protein)
    contains a few insertion and C-terminal extension compared with Bet v1
  6. 418422Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (1 species)
  7. 418423Species Pseudomonas putida [TaxId:303] [55971] (8 PDB entries)
  8. 418432Domain d1ndoc2: 1ndo C:155-447 [41324]
    Other proteins in same PDB: d1ndoa1, d1ndob_, d1ndoc1, d1ndod_, d1ndoe1, d1ndof_

Details for d1ndoc2

PDB Entry: 1ndo (more details), 2.25 Å

PDB Description: napthalene 1,2-dioxygenase

SCOP Domain Sequences for d1ndoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndoc2 d.129.3.3 (C:155-447) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltktt

SCOP Domain Coordinates for d1ndoc2:

Click to download the PDB-style file with coordinates for d1ndoc2.
(The format of our PDB-style files is described here.)

Timeline for d1ndoc2: