Lineage for d1fskg_ (1fsk G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2214909Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2214919Protein Major tree pollen allergen [55963] (4 species)
  7. 2214922Species European white birch (Betula pendula), Bet v I-a [TaxId:3505] [55965] (1 PDB entry)
  8. 2214925Domain d1fskg_: 1fsk G: [41319]
    Other proteins in same PDB: d1fskb1, d1fskb2, d1fskc1, d1fskc2, d1fske1, d1fske2, d1fskf1, d1fskf2, d1fskh1, d1fskh2, d1fski1, d1fski2, d1fskk1, d1fskk2, d1fskl1, d1fskl2

Details for d1fskg_

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1
PDB Compounds: (G:) major pollen allergen bet v 1-a

SCOPe Domain Sequences for d1fskg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fskg_ d.129.3.1 (G:) Major tree pollen allergen {European white birch (Betula pendula), Bet v I-a [TaxId: 3505]}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOPe Domain Coordinates for d1fskg_:

Click to download the PDB-style file with coordinates for d1fskg_.
(The format of our PDB-style files is described here.)

Timeline for d1fskg_: