Lineage for d1fska_ (1fsk A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610723Fold d.129: TBP-like [55944] (9 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 610890Superfamily d.129.3: Bet v1-like [55961] (6 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 610891Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (3 proteins)
  6. 610896Protein Major tree pollen allergen [55963] (4 species)
  7. 610899Species European white birch (Betula pendula), Bet v I-a [TaxId:3505] [55965] (1 PDB entry)
  8. 610900Domain d1fska_: 1fsk A: [41317]
    Other proteins in same PDB: d1fskb1, d1fskb2, d1fskc1, d1fskc2, d1fske1, d1fske2, d1fskf1, d1fskf2, d1fskh1, d1fskh2, d1fski1, d1fski2, d1fskk1, d1fskk2, d1fskl1, d1fskl2

Details for d1fska_

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

SCOP Domain Sequences for d1fska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fska_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v I-a}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOP Domain Coordinates for d1fska_:

Click to download the PDB-style file with coordinates for d1fska_.
(The format of our PDB-style files is described here.)

Timeline for d1fska_: