Lineage for d1qmra_ (1qmr A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539013Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2539023Protein Major tree pollen allergen [55963] (4 species)
  7. 2539034Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (23 PDB entries)
  8. 2539054Domain d1qmra_: 1qmr A: [41314]
    mutant

Details for d1qmra_

PDB Entry: 1qmr (more details), 2.15 Å

PDB Description: birch pollen allergen bet v 1 mutant n28t, k32q, e45s, p108g
PDB Compounds: (A:) major pollen allergen bet v 1-a

SCOPe Domain Sequences for d1qmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmra_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildgdtlfpqvapqaissvenisgnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatgdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOPe Domain Coordinates for d1qmra_:

Click to download the PDB-style file with coordinates for d1qmra_.
(The format of our PDB-style files is described here.)

Timeline for d1qmra_: