SCOP 1.59: Domain d1ytfa2: 1ytf A:156-240

Lineage for d1ytfa2 (1ytf A:156-240)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (4 PDB entries)

8. Domain d1ytfa2: 1ytf A:156-240 [41281]
   Other proteins in same PDB: d1ytfb1, d1ytfc1, d1ytfd1, d1ytfd2

Details for d1ytfa2

PDB Entry: 1ytf, 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

SCOP Domain Sequences for d1ytfa2:

Sequence; same for both SEQRES and ATOM records:

>d1ytfa2 d.129.1.1 (A:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

Timeline for d1ytfa2:

• d1ytfa2 first appeared (with stable ids) in SCOP 1.55
  
• d1ytfa2 appears in SCOP 1.57
  
• d1ytfa2 appears in SCOP 1.61
  
• d1ytfa2 appears in the current release, SCOPe 2.08