Lineage for d1ytfa1 (1ytf A:61-155)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262082Fold d.129: TBP-like [55944] (4 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 262083Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 262084Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 262085Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
    structure of the N-terminal domain is not known yet
  7. 262146Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (4 PDB entries)
  8. 262151Domain d1ytfa1: 1ytf A:61-155 [41280]
    Other proteins in same PDB: d1ytfb_, d1ytfc_, d1ytfd1, d1ytfd2

Details for d1ytfa1

PDB Entry: 1ytf (more details), 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

SCOP Domain Sequences for d1ytfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytfa1 d.129.1.1 (A:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdf

SCOP Domain Coordinates for d1ytfa1:

Click to download the PDB-style file with coordinates for d1ytfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ytfa1: