Lineage for d7m6da_ (7m6d A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758537Domain d7m6da_: 7m6d A: [412626]
    Other proteins in same PDB: d7m6dc_, d7m6dh_, d7m6dl1, d7m6dl2
    automated match to d6shgh_

Details for d7m6da_

PDB Entry: 7m6d (more details), 3.1 Å

PDB Description: structure of the sars-cov-2 rbd in complex with neutralizing antibodies bg4-25 and cr3022
PDB Compounds: (A:) CR3022 Fab heavy chain

SCOPe Domain Sequences for d7m6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m6da_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qmqlvqsgtevkkpgeslkisckgsgygfitywigwvrqmpgkglewmgiiypgdsetry
spsfqgqvtisadksintaylqwsslkasdtaiyycaggsgistpmdvwgqgttvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d7m6da_:

Click to download the PDB-style file with coordinates for d7m6da_.
(The format of our PDB-style files is described here.)

Timeline for d7m6da_:

  • d7m6da_ is new in SCOPe 2.08-stable