Lineage for d7kfvh_ (7kfv H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742487Domain d7kfvh_: 7kfv H: [412533]
    Other proteins in same PDB: d7kfva_, d7kfvb_, d7kfvd1, d7kfvd2, d7kfve_, d7kfvg1, d7kfvg2, d7kfvl1, d7kfvl2
    automated match to d6shgh_
    complexed with nag

Details for d7kfvh_

PDB Entry: 7kfv (more details), 2.1 Å

PDB Description: structural basis for a germline-biased antibody response to sars-cov-2 (rbd:c1a-b12 fab)
PDB Compounds: (H:) Heavy chain of antibody C1A-B12 Fab

SCOPe Domain Sequences for d7kfvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kfvh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggliqpggslrlscaasgftvssnymswvrqapgkglewvsviysggatyya
dsvkgrftisrdnskntlylqmnslraedtavyycargdvsgyrygldywgqgtlvtvsg
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdr

SCOPe Domain Coordinates for d7kfvh_:

Click to download the PDB-style file with coordinates for d7kfvh_.
(The format of our PDB-style files is described here.)

Timeline for d7kfvh_:

  • d7kfvh_ is new in SCOPe 2.08-stable