Lineage for d7k9zh_ (7k9z H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758508Domain d7k9zh_: 7k9z H: [412526]
    Other proteins in same PDB: d7k9za2, d7k9ze_, d7k9zl2
    automated match to d6shgh_
    complexed with nag

Details for d7k9zh_

PDB Entry: 7k9z (more details), 2.95 Å

PDB Description: crystal structure of sars-cov-2 receptor binding domain in complex with the fab fragments of neutralizing antibodies 298 and 52
PDB Compounds: (H:) 52 Fab Heavy Chain

SCOPe Domain Sequences for d7k9zh_:

Sequence, based on SEQRES records: (download)

>d7k9zh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasgytftsygiswvrqapgqglewmggiipmfgttny
aqkfqgrvtitadkststaymelsslrsedtavyycardrgdtidywgqgtlvtvssast
kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d7k9zh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasgytftsygiswvrqapgqglewmggiipmfgttny
aqkfqgrvtitadkststaymelsslrsedtavyycardrgdtidywgqgtlvtvssast
kgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d7k9zh_:

Click to download the PDB-style file with coordinates for d7k9zh_.
(The format of our PDB-style files is described here.)

Timeline for d7k9zh_:

  • d7k9zh_ is new in SCOPe 2.08-stable