Lineage for d7eamc_ (7eam C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744185Domain d7eamc_: 7eam C: [412469]
    Other proteins in same PDB: d7eama_, d7eamb_, d7eamd1, d7eamd2, d7eaml1, d7eaml2
    automated match to d6shgh_
    complexed with nag

Details for d7eamc_

PDB Entry: 7eam (more details), 1.4 Å

PDB Description: immune complex of sars-cov-2 rbd and cross-neutralizing antibody 7d6
PDB Compounds: (C:) the heavy chain of Fab fragment of antibody 7D6

SCOPe Domain Sequences for d7eamc_:

Sequence, based on SEQRES records: (download)

>d7eamc_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvrpgasvklsctasgfnikdtyihwvkqrpeqglewigridpgdgdtey
dpsfqgkatitadtssntaylelssltsedtavyyctrfydyvnygmdywgqgtsvtvss
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d7eamc_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvrpgasvklsctasgfnikdtyihwvkqrpeqglewigridpgdgdtey
dpsfqgkatitadtssntaylelssltsedtavyyctrfydyvnygmdywgqgtsvtvss
akttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d7eamc_:

Click to download the PDB-style file with coordinates for d7eamc_.
(The format of our PDB-style files is described here.)

Timeline for d7eamc_:

  • d7eamc_ is new in SCOPe 2.08-stable