Lineage for d7e8fh_ (7e8f H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743472Domain d7e8fh_: 7e8f H: [412465]
    Other proteins in same PDB: d7e8fb_, d7e8fl1, d7e8fr_
    automated match to d6shgh_

Details for d7e8fh_

PDB Entry: 7e8f (more details), 3.18 Å

PDB Description: sars-cov-2 ntd in complex with n9 fab
PDB Compounds: (H:) n9 h

SCOPe Domain Sequences for d7e8fh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e8fh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvkpggslrlscaaseftfssysmnwvrqapgkglewvssisssgsqiyya
dsvkgrftisrdnakkslylqmnslrvedtavyycatnggahsstwsfygmdvwgqgttv
tvss

SCOPe Domain Coordinates for d7e8fh_:

Click to download the PDB-style file with coordinates for d7e8fh_.
(The format of our PDB-style files is described here.)

Timeline for d7e8fh_:

  • d7e8fh_ is new in SCOPe 2.08-stable