Lineage for d2crka2 (2crk A:103-381)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668438Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1668439Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 1668564Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 1668588Protein Creatine kinase, C-terminal domain [55936] (7 species)
  7. 1668618Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55940] (2 PDB entries)
  8. 1668621Domain d2crka2: 2crk A:103-381 [41209]
    Other proteins in same PDB: d2crka1
    complexed with so4

Details for d2crka2

PDB Entry: 2crk (more details), 2.35 Å

PDB Description: muscle creatine kinase
PDB Compounds: (A:) protein (creatine kinase)

SCOPe Domain Sequences for d2crka2:

Sequence, based on SEQRES records: (download)

>d2crka2 d.128.1.2 (A:103-381) Creatine kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tdkhktdlnhenlkggddldphyvlssrvrtgrsikgytlpphcsrgerraveklsveal
nsltgefkgkyyplksmteqeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ksflvwvneedhlrvismekggnmkevfrrfcvglqkieeifkkaghpfmwnehlgyvlt
cpsnlgtglrggvhvklahlskhpkfeeiltrlrlqkrgtsvfdtaavgsvfdisnadrl
gsseveqvqlvvdgvklmvemekklekgqsiddmipaqk

Sequence, based on observed residues (ATOM records): (download)

>d2crka2 d.128.1.2 (A:103-381) Creatine kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tdkhktdlnhenlkggddldphyvlssrvrtgrsikgytlpphcsrgerraveklsveal
nsltgefkgkyyplksmteqeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ksflvwvneedhlrvismekggnmkevfrrfcvglqkieeifkkaghpfmwnehlgyvlt
cpsnlgtglrggvhvklahlskhpkfeeiltrlrlqkrgtsvfdisnadrlgsseveqvq
lvvdgvklmvemekklekgqsiddmipaqk

SCOPe Domain Coordinates for d2crka2:

Click to download the PDB-style file with coordinates for d2crka2.
(The format of our PDB-style files is described here.)

Timeline for d2crka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2crka1