Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
Protein Creatine kinase, C-terminal domain [55936] (7 species) |
Species Human (Homo sapiens), mitochondria [TaxId:9606] [55939] (1 PDB entry) |
Domain d1qk1g2: 1qk1 G:103-379 [41207] Other proteins in same PDB: d1qk1a1, d1qk1b1, d1qk1c1, d1qk1d1, d1qk1e1, d1qk1f1, d1qk1g1, d1qk1h1 complexed with po4 |
PDB Entry: 1qk1 (more details), 2.7 Å
SCOPe Domain Sequences for d1qk1g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qk1g2 d.128.1.2 (G:103-379) Creatine kinase, C-terminal domain {Human (Homo sapiens), mitochondria [TaxId: 9606]} ttdldaskirsgyfderyvlssrvrtgrsirglslppactraerrevervvvdalsglkg dlagryyrlsemteaeqqqliddhflfdkpvsplltaagmardwpdargiwhnneksfli wvneedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnl gtglragvhiklpllskdsrfpkilenlrlqkrgtggvdtaatggvfdisnldrlgksev elvqlvidgvnylidcerrlergqdiriptpvihtkh
Timeline for d1qk1g2: