SCOPe 2.08: Domain d6w0ja1: 6w0j A:6-219

Lineage for d6w0ja1 (6w0j A:6-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (25 PDB entries)

8. Domain d6w0ja1: 6w0j A:6-219 [412059]
   Other proteins in same PDB: d6w0ja2, d6w0jb1, d6w0jb2, d6w0jc_
   automated match to d6shgh_
   complexed with ba

Details for d6w0ja1

PDB Entry: 6w0j, 2.5 Å

PDB Description: closed-gate kcsa incubated in bacl2/nacl

PDB Compounds: (A:) Fab heavy chain

SCOPe Domain Sequences for d6w0ja1:

Sequence; same for both SEQRES and ATOM records:

>d6w0ja1 b.1.1.1 (A:6-219) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygranynekiq
kkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssakttpps
vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpssswpsetvtcnvahpasstkvdkkivprd

Timeline for d6w0ja1:

• d6w0ja1 is new in SCOPe 2.08-stable