Lineage for d1qk1c2 (1qk1 C:103-379)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35661Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 35662Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 35692Family d.128.1.2: Guanido kinases [55935] (2 proteins)
  6. 35696Protein Creatine kinase, C-terminal domain [55936] (5 species)
  7. 35709Species Human (Homo sapiens), mitochondria [TaxId:9606] [55939] (1 PDB entry)
  8. 35712Domain d1qk1c2: 1qk1 C:103-379 [41203]
    Other proteins in same PDB: d1qk1a1, d1qk1b1, d1qk1c1, d1qk1d1, d1qk1e1, d1qk1f1, d1qk1g1, d1qk1h1

Details for d1qk1c2

PDB Entry: 1qk1 (more details), 2.7 Å

PDB Description: crystal structure of human ubiquitous mitochondrial creatine kinase

SCOP Domain Sequences for d1qk1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qk1c2 d.128.1.2 (C:103-379) Creatine kinase, C-terminal domain {Human (Homo sapiens), mitochondria}
ttdldaskirsgyfderyvlssrvrtgrsirglslppactraerrevervvvdalsglkg
dlagryyrlsemteaeqqqliddhflfdkpvsplltaagmardwpdargiwhnneksfli
wvneedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnl
gtglragvhiklpllskdsrfpkilenlrlqkrgtggvdtaatggvfdisnldrlgksev
elvqlvidgvnylidcerrlergqdiriptpvihtkh

SCOP Domain Coordinates for d1qk1c2:

Click to download the PDB-style file with coordinates for d1qk1c2.
(The format of our PDB-style files is described here.)

Timeline for d1qk1c2: