Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins) |
Protein Glutamine synthetase, C-terminal domain [55933] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries) |
Domain d2glsj2: 2gls J:101-468 [41190] Other proteins in same PDB: d2glsa1, d2glsb1, d2glsc1, d2glsd1, d2glse1, d2glsf1, d2glsg1, d2glsh1, d2glsi1, d2glsj1, d2glsk1, d2glsl1 complexed with mn |
PDB Entry: 2gls (more details), 3.5 Å
SCOPe Domain Sequences for d2glsj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glsj2 d.128.1.1 (J:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv efelyysv
Timeline for d2glsj2: