SCOP 1.71: Domain d1f52l2: 1f52 L:101-468

Lineage for d1f52l2 (1f52 L:101-468)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (4 families)

5. Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)

6. Protein Glutamine synthetase, C-terminal domain [55933] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)

8. Domain d1f52l2: 1f52 L:101-468 [41180]
   Other proteins in same PDB: d1f52a1, d1f52b1, d1f52c1, d1f52d1, d1f52e1, d1f52f1, d1f52g1, d1f52h1, d1f52i1, d1f52j1, d1f52k1, d1f52l1
   complexed with adp, mn, mpd

Details for d1f52l2

PDB Entry: 1f52, 2.49 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with adp

SCOP Domain Sequences for d1f52l2:

Sequence; same for both SEQRES and ATOM records:

>d1f52l2 d.128.1.1 (L:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

Timeline for d1f52l2:

• d1f52l2 first appeared (with stable ids) in SCOP 1.55
  
• d1f52l2 appears in SCOP 1.69
  
• d1f52l2 appears in SCOP 1.73
  
• d1f52l2 appears in the current release, SCOPe 2.08