Lineage for d1f52f2 (1f52 F:101-468)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83743Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 83744Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 83745Family d.128.1.1: Glutamine synthetase, C-terminal domain [55932] (1 protein)
  6. 83746Protein Glutamine synthetase, C-terminal domain [55933] (1 species)
  7. 83747Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)
  8. 83755Domain d1f52f2: 1f52 F:101-468 [41174]
    Other proteins in same PDB: d1f52a1, d1f52b1, d1f52c1, d1f52d1, d1f52e1, d1f52f1, d1f52g1, d1f52h1, d1f52i1, d1f52j1, d1f52k1, d1f52l1

Details for d1f52f2

PDB Entry: 1f52 (more details), 2.49 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with adp

SCOP Domain Sequences for d1f52f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f52f2 d.128.1.1 (F:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

SCOP Domain Coordinates for d1f52f2:

Click to download the PDB-style file with coordinates for d1f52f2.
(The format of our PDB-style files is described here.)

Timeline for d1f52f2: