Lineage for d6pzyh_ (6pzy H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757743Domain d6pzyh_: 6pzy H: [411702]
    Other proteins in same PDB: d6pzya_, d6pzyb_, d6pzye_, d6pzyf_
    automated match to d6shgh_
    complexed with nag

Details for d6pzyh_

PDB Entry: 6pzy (more details), 3.17 Å

PDB Description: cryoem derived model of na-73 fab in complex with n9 shanghai2
PDB Compounds: (H:) NA-73 fragment antibody heavy chain

SCOPe Domain Sequences for d6pzyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pzyh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqleesgpglvkpsetlsltctvsgytissgyywgwirqppgkglewigcnnhrgssyy
npslksrviisvdttknkfslklssvtaadtavyycardpsfwsstsrtspyyygmdvwg
qgtlvtvss

SCOPe Domain Coordinates for d6pzyh_:

Click to download the PDB-style file with coordinates for d6pzyh_.
(The format of our PDB-style files is described here.)

Timeline for d6pzyh_:

  • d6pzyh_ is new in SCOPe 2.08-stable