![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) |
![]() | Protein Aminopeptidase P, C-terminal domain [55928] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55929] (26 PDB entries) |
![]() | Domain d1jawa2: 1jaw A:177-440 [41166] Other proteins in same PDB: d1jawa1 complexed with act, mn |
PDB Entry: 1jaw (more details), 2.7 Å
SCOP Domain Sequences for d1jawa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jawa2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaarkq
Timeline for d1jawa2: