Lineage for d6p4ch_ (6p4c H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744308Domain d6p4ch_: 6p4c H: [411619]
    Other proteins in same PDB: d6p4cl1, d6p4cl2
    automated match to d6shgh_
    complexed with cl; mutant

Details for d6p4ch_

PDB Entry: 6p4c (more details), 1.85 Å

PDB Description: hyhel10 fab carrying four heavy chain mutations (hyhel10-4x): l4f, y33h, s56n, and y58f
PDB Compounds: (H:) HyHEL10 Fab heavy chain

SCOPe Domain Sequences for d6p4ch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p4ch_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqfqesgpslvkpsqtlsltcsvtgdsitsdhwswirkfpgnrleymgyvsysgntfynp
slksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaakttppsv
yplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
tvpsstwpsqtvtcnvahpasstkvdkkivprd

SCOPe Domain Coordinates for d6p4ch_:

Click to download the PDB-style file with coordinates for d6p4ch_.
(The format of our PDB-style files is described here.)

Timeline for d6p4ch_:

  • d6p4ch_ is new in SCOPe 2.08-stable