Lineage for d6oy4d_ (6oy4 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744968Domain d6oy4d_: 6oy4 D: [411608]
    Other proteins in same PDB: d6oy4a_, d6oy4c2
    automated match to d6shgh_
    complexed with so4

Details for d6oy4d_

PDB Entry: 6oy4 (more details), 2.45 Å

PDB Description: crystal structure of complex between recombinant der p 2.0103 and fab fragment of 7a1
PDB Compounds: (D:) Fab fragment of IgG, LIGHT CHAIN

SCOPe Domain Sequences for d6oy4d_:

Sequence, based on SEQRES records: (download)

>d6oy4d_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqlvqsgpelkkpgetikisckasgytftnygmnwvkqtpgkglkwmgwinpytgeeps
yaddfkgrfafsletsantaylqinnlnnedmatyfcarggftdyygmdywgqgtsvtvs
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgsassgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d6oy4d_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqlvqsgpelkkpgetikisckasgytftnygmnwvkqtpgkglkwmgwinpytgeeps
yaddfkgrfafsletsantaylqinnlnnedmatyfcarggftdyygmdywgqgtsvtvs
sakttppsvyplapgsnsmvtlgclvkgyfpepvtvtwnsgsassgvhtfpavlqsdlyt
lsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d6oy4d_:

Click to download the PDB-style file with coordinates for d6oy4d_.
(The format of our PDB-style files is described here.)

Timeline for d6oy4d_:

  • d6oy4d_ is new in SCOPe 2.08-stable