Lineage for d6oorh_ (6oor H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745381Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (25 PDB entries)
  8. 2745410Domain d6oorh_: 6oor H: [411605]
    Other proteins in same PDB: d6oora1, d6oora2, d6oorb_, d6oorl1, d6oorl2
    automated match to d6shgh_
    complexed with na, unl

Details for d6oorh_

PDB Entry: 6oor (more details), 2.45 Å

PDB Description: structure of 1b1 bound to mouse cd1d
PDB Compounds: (H:) Antibody 1B1 Heavy chain

SCOPe Domain Sequences for d6oorh_:

Sequence, based on SEQRES records: (download)

>d6oorh_ b.1.1.1 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqlvesggvlvqpgrslklscaasgfpfnnydmawvrqaptkglewvasirtgdigtyyr
dsvkgrftvsrdnakstlylqmdslrsedtatyycvrprsvyyglllrpywffdfwgpgt
mvtvssaqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfp
avlqsglytltssvtsstwpsqtvtcnvahpasstkvdkav

Sequence, based on observed residues (ATOM records): (download)

>d6oorh_ b.1.1.1 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqlvesggvlvqpgrslklscaasgfpfnnydmawvrqaptkglewvasirtgdigtyyr
dsvkgrftvsrdnakstlylqmdslrsedtatyycvrprsvyyglllrpywffdfwgpgt
mvtvssaqttapsvyplapgctsstvtlgclvkgyfpepvtvtwnsgasdvhtfpavlqs
glytltssvtsstwpsqtvtcnvahpasstkvdkav

SCOPe Domain Coordinates for d6oorh_:

Click to download the PDB-style file with coordinates for d6oorh_.
(The format of our PDB-style files is described here.)

Timeline for d6oorh_:

  • d6oorh_ is new in SCOPe 2.08-stable