Lineage for d1g61b_ (1g61 B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83676Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
  4. 83677Superfamily d.126.1: Pentein [55909] (3 families) (S)
  5. 83678Family d.126.1.1: Ribosome anti-association factor eIF6 (aIF6) [55910] (1 protein)
  6. 83679Protein Ribosome anti-association factor eIF6 (aIF6) [55911] (2 species)
  7. 83680Species Archaeon Methanococcus jannaschii [TaxId:2190] [55912] (1 PDB entry)
  8. 83682Domain d1g61b_: 1g61 B: [41127]

Details for d1g61b_

PDB Entry: 1g61 (more details), 1.3 Å

PDB Description: crystal structure of m.jannaschii eif6

SCOP Domain Sequences for d1g61b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g61b_ d.126.1.1 (B:) Ribosome anti-association factor eIF6 (aIF6) {Archaeon Methanococcus jannaschii}
miirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvgsl
svankyglllpkivedeeldriknflkennldlnveiikskntalgnliltndkgalisp
elkdfkkdiedslnveveigtiaelptvgsnavvtnkgclthplveddeleflkslfkve
yigkgtankgttsvgaciianskgavvggdttgpelliiedalgl

SCOP Domain Coordinates for d1g61b_:

Click to download the PDB-style file with coordinates for d1g61b_.
(The format of our PDB-style files is described here.)

Timeline for d1g61b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g61a_