SCOPe 2.07: Domain d1g61a_: 1g61 A:

Lineage for d1g61a_ (1g61 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.1: Ribosome anti-association factor eIF6 (aIF6) [55910] (2 proteins)
   automatically mapped to Pfam PF01912

6. Protein Ribosome anti-association factor eIF6 (aIF6) [55911] (2 species)

7. Species Methanococcus jannaschii [TaxId:2190] [55912] (1 PDB entry)

8. Domain d1g61a_: 1g61 A: [41126]

Details for d1g61a_

PDB Entry: 1g61, 1.3 Å

PDB Description: crystal structure of m.jannaschii eif6

PDB Compounds: (A:) translation initiation factor 6

SCOPe Domain Sequences for d1g61a_:

Sequence; same for both SEQRES and ATOM records:

>d1g61a_ d.126.1.1 (A:) Ribosome anti-association factor eIF6 (aIF6) {Methanococcus jannaschii [TaxId: 2190]}
miirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvgsl
svankyglllpkivedeeldriknflkennldlnveiikskntalgnliltndkgalisp
elkdfkkdiedslnveveigtiaelptvgsnavvtnkgclthplveddeleflkslfkve
yigkgtankgttsvgaciianskgavvggdttgpelliiedalgl

Timeline for d1g61a_:

• d1g61a_ first appeared (with stable ids) in SCOP 1.55
  
• d1g61a_ appears in SCOPe 2.06
  
• d1g61a_ appears in the current release, SCOPe 2.08