Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) |
Superfamily d.126.1: Pentein [55909] (3 families) |
Family d.126.1.1: Ribosome anti-association factor eIF6 (aIF6) [55910] (1 protein) |
Protein Ribosome anti-association factor eIF6 (aIF6) [55911] (2 species) |
Species Archaeon Methanococcus jannaschii [TaxId:2190] [55912] (1 PDB entry) |
Domain d1g61a_: 1g61 A: [41126] |
PDB Entry: 1g61 (more details), 1.3 Å
SCOP Domain Sequences for d1g61a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g61a_ d.126.1.1 (A:) Ribosome anti-association factor eIF6 (aIF6) {Archaeon Methanococcus jannaschii} miirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvgsl svankyglllpkivedeeldriknflkennldlnveiikskntalgnliltndkgalisp elkdfkkdiedslnveveigtiaelptvgsnavvtnkgclthplveddeleflkslfkve yigkgtankgttsvgaciianskgavvggdttgpelliiedalgl
Timeline for d1g61a_: