Lineage for d1g61a_ (1g61 A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) Superfamily d.126.1: Pentein [55909] (2 families) 
Family d.126.1.1: Ribosome anti-association factor eIF6 (aIF6) [55910] (1 protein) Protein Ribosome anti-association factor eIF6 (aIF6) [55911] (2 species) Species Archaea (Methanococcus jannaschii) [TaxId:2190] [55912] (1 PDB entry) 
Domain d1g61a_: 1g61 A: [41126]
Details for d1g61a_
PDB Entry: 1g61 (more details), 1.3 Å
PDB Description: crystal structure of m.jannaschii eif6
SCOP Domain Sequences for d1g61a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g61a_ d.126.1.1 (A:) Ribosome anti-association factor eIF6 (aIF6) {Archaea (Methanococcus jannaschii)}
miirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvgsl
svankyglllpkivedeeldriknflkennldlnveiikskntalgnliltndkgalisp
elkdfkkdiedslnveveigtiaelptvgsnavvtnkgclthplveddeleflkslfkve
yigkgtankgttsvgaciianskgavvggdttgpelliiedalgl
SCOP Domain Coordinates for d1g61a_:
Click to download the PDB-style file with coordinates for d1g61a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g61a_:
- d1g61a_ appears in SCOP 1.57
- d1g61a_ appears in the current release, SCOPe 2.08
View in 3D
