Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
Superfamily d.126.1: Pentein [55909] (8 families) |
Family d.126.1.1: Ribosome anti-association factor eIF6 (aIF6) [55910] (2 proteins) automatically mapped to Pfam PF01912 |
Protein Ribosome anti-association factor eIF6 (aIF6) [55911] (2 species) |
Species Methanococcus jannaschii [TaxId:2190] [55912] (1 PDB entry) |
Domain d1g61a_: 1g61 A: [41126] |
PDB Entry: 1g61 (more details), 1.3 Å
SCOPe Domain Sequences for d1g61a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g61a_ d.126.1.1 (A:) Ribosome anti-association factor eIF6 (aIF6) {Methanococcus jannaschii [TaxId: 2190]} miirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvgsl svankyglllpkivedeeldriknflkennldlnveiikskntalgnliltndkgalisp elkdfkkdiedslnveveigtiaelptvgsnavvtnkgclthplveddeleflkslfkve yigkgtankgttsvgaciianskgavvggdttgpelliiedalgl
Timeline for d1g61a_: