Lineage for d1bknb2 (1bkn B:420-616)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35530Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
  4. 35531Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (3 families) (S)
  5. 35547Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (2 proteins)
  6. 35553Protein DNA mismatch repair protein MutL [55882] (1 species)
  7. 35554Species Escherichia coli [TaxId:562] [55883] (3 PDB entries)
  8. 35558Domain d1bknb2: 1bkn B:420-616 [41110]
    Other proteins in same PDB: d1bkna1, d1bknb1

Details for d1bknb2

PDB Entry: 1bkn (more details), 2.9 Å

PDB Description: crystal structure of an n-terminal 40kd fragment of e. coli dna mismatch repair protein mutl

SCOP Domain Sequences for d1bknb2:

Sequence, based on SEQRES records: (download)

>d1bknb2 d.122.1.2 (B:420-616) DNA mismatch repair protein MutL {Escherichia coli}
verpasvvkelvensldagatrididierggaklirirdngcgikkdelalalarhatsk
iaslddleaiislgfrgealasissvsrltltsrtaeqqeawqayaegrdmnvtvkpaah
pvgttlevldlfyntparrkflrtektefnhideiirrialarfdvtinlshngkivrqy
ravpeggqkerrlgaic

Sequence, based on observed residues (ATOM records): (download)

>d1bknb2 d.122.1.2 (B:420-616) DNA mismatch repair protein MutL {Escherichia coli}
verpasvvkelvensldagatrididierggaklirirdngcgikkdelalalaeaiisl
gfrgealasissvsrltltsrtaeqqeawqaymnvtvkpaahpvgttlevldllrtekte
fnhideiirrialarfdvtinlshngkivrqyravpeggqkerrlgaic

SCOP Domain Coordinates for d1bknb2:

Click to download the PDB-style file with coordinates for d1bknb2.
(The format of our PDB-style files is described here.)

Timeline for d1bknb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bknb1