Lineage for d1b62a2 (1b62 A:1-216)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510439Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 510440Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 510484Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (6 proteins)
  6. 510494Protein DNA mismatch repair protein MutL [55882] (1 species)
  7. 510495Species Escherichia coli [TaxId:562] [55883] (6 PDB entries)
  8. 510498Domain d1b62a2: 1b62 A:1-216 [41108]
    Other proteins in same PDB: d1b62a1

Details for d1b62a2

PDB Entry: 1b62 (more details), 2.1 Å

PDB Description: mutl complexed with adp

SCOP Domain Sequences for d1b62a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b62a2 d.122.1.2 (A:1-216) DNA mismatch repair protein MutL {Escherichia coli}
mpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirirdng
cgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqqea
wqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirrial
arfdvtinlshngkivrqyravpeggqkerrlgaic

SCOP Domain Coordinates for d1b62a2:

Click to download the PDB-style file with coordinates for d1b62a2.
(The format of our PDB-style files is described here.)

Timeline for d1b62a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b62a1