Lineage for d1ei1b2 (1ei1 B:402-620)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871740Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 871741Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 871855Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (6 proteins)
  6. 871856Protein DNA gyrase B [55880] (2 species)
  7. 871857Species Escherichia coli [TaxId:562] [55881] (3 PDB entries)
  8. 871859Domain d1ei1b2: 1ei1 B:402-620 [41105]
    Other proteins in same PDB: d1ei1a1, d1ei1b1
    complexed with anp, gol, so4; mutant

Details for d1ei1b2

PDB Entry: 1ei1 (more details), 2.3 Å

PDB Description: dimerization of e. coli dna gyrase b provides a structural mechanism for activating the atpase catalytic center
PDB Compounds: (B:) DNA gyrase b

SCOP Domain Sequences for d1ei1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ei1b2 d.122.1.2 (B:402-620) DNA gyrase B {Escherichia coli [TaxId: 562]}
snssdsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiiv
tihadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvs
vvnalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvte
feyeilakrlrelsfldsgvsirlrdkrdgkedhfhyeg

SCOP Domain Coordinates for d1ei1b2:

Click to download the PDB-style file with coordinates for d1ei1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ei1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ei1b1