Lineage for d6c6xc1 (6c6x C:6-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761531Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)
  8. 2761589Domain d6c6xc1: 6c6x C:6-214 [410924]
    Other proteins in same PDB: d6c6xa2, d6c6xc2, d6c6xe2, d6c6xh2
    automated match to d6shgh_

Details for d6c6xc1

PDB Entry: 6c6x (more details), 1.99 Å

PDB Description: crystal structure of middle-east respiratory syndrome (mers) coronavirus neutralizing antibody jc57-14 isolated from a vaccinated rhesus macaque.
PDB Compounds: (C:) JC57-14 Heavy chain

SCOPe Domain Sequences for d6c6xc1:

Sequence, based on SEQRES records: (download)

>d6c6xc1 b.1.1.0 (C:6-214) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
esgpglvkpsetlsltcavsgdsissnywswirqppgkglewigrfsgsggstdfnpslk
srvtistdtsknqfslnlrsvtaadtavyycaktysgtfdywgqgvlvtvssastkgpsv
fplapssrstsestaalgclvkdyfpepvtvswnsgsltsgvhtfpavlqssglyslssv
vtvpssslgtqtyvcnvnhkpsntkvdkrveik

Sequence, based on observed residues (ATOM records): (download)

>d6c6xc1 b.1.1.0 (C:6-214) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
esgpglvkpsetlsltcavsgdsissnywswirqppgkglewigrfsgsggstdfnpslk
srvtistdtsknqfslnlrsvtaadtavyycaktysgtfdywgqgvlvtvssastkgpsv
fplapsestaalgclvkdyfpepvtvswnsgsltsgvhtfpavlqssglyslssvvtvps
sslgtqtyvcnvnhkpsntkvdkrveik

SCOPe Domain Coordinates for d6c6xc1:

Click to download the PDB-style file with coordinates for d6c6xc1.
(The format of our PDB-style files is described here.)

Timeline for d6c6xc1:

  • d6c6xc1 is new in SCOPe 2.08-stable