SCOP 1.55: Domain d1soxb2: 1sox B:3-93

Lineage for d1soxb2 (1sox B:3-93)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.120: Cytochrome b5 [55855] (1 superfamily)

4. Superfamily d.120.1: Cytochrome b5 [55856] (1 family)

5. Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)

6. Protein Sulfite oxidase, N-terminal domain [55866] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [55867] (1 PDB entry)

8. Domain d1soxb2: 1sox B:3-93 [41091]
   Other proteins in same PDB: d1soxa1, d1soxa3, d1soxb1, d1soxb3

Details for d1soxb2

PDB Entry: 1sox, 1.9 Å

PDB Description: sulfite oxidase from chicken liver

SCOP Domain Sequences for d1soxb2:

Sequence, based on SEQRES records:

>d1soxb2 d.120.1.1 (B:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus)}
sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly
avhgephvlellqqykvgelspdeapaapda

Sequence, based on observed residues (ATOM records):

>d1soxb2 d.120.1.1 (B:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus)}
sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly
avhgephvlellqqykvgelspdda

Timeline for d1soxb2:

• d1soxb2 appears in SCOP 1.57
  
• d1soxb2 appears in the current release, SCOPe 2.08