Lineage for d1wdb__ (1wdb -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261676Fold d.120: Cytochrome b5 [55855] (1 superfamily)
    small, heme-binding fold
  4. 261677Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 261678Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 261679Protein Cytochrome b5 [55858] (3 species)
  7. 261680Species Cow (Bos taurus) [TaxId:9913] [55859] (10 PDB entries)
  8. 261690Domain d1wdb__: 1wdb - [41070]
    complexed with hem

Details for d1wdb__

PDB Entry: 1wdb (more details)

PDB Description: nmr solution structure of bovine cytochrome b5, minimized average structure

SCOP Domain Sequences for d1wdb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdb__ d.120.1.1 (-) Cytochrome b5 {Cow (Bos taurus)}
skavkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktfiigelhpddr

SCOP Domain Coordinates for d1wdb__:

Click to download the PDB-style file with coordinates for d1wdb__.
(The format of our PDB-style files is described here.)

Timeline for d1wdb__: