SCOPe 2.08: Domain d5ikcb1: 5ikc B:2-215

Lineage for d5ikcb1 (5ikc B:2-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d5ikcb1: 5ikc B:2-215 [410183]
   Other proteins in same PDB: d5ikca1, d5ikca2, d5ikca3, d5ikcb2, d5ikch2, d5ikcl1, d5ikcl2, d5ikcl3, d5ikcm1, d5ikcm2, d5ikcn1, d5ikcn2
   automated match to d6shgh_
   complexed with cl

Details for d5ikcb1

PDB Entry: 5ikc, 2.06 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin in complex with fab

PDB Compounds: (B:) Ighg protein

SCOPe Domain Sequences for d5ikcb1:

Sequence, based on SEQRES records:

>d5ikcb1 b.1.1.1 (B:2-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlqqsgadlvrpgasvklsctasgfdikddyvhwvkqrpeqglewigridpangatkya
pkfqdkatltadtssntaylqlssltsedtavyycgrskyfdswgqgttltvssakttpp
svyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmss
svtvpsstwpsqtvtcsvahpassttvdkkleps

Sequence, based on observed residues (ATOM records):

>d5ikcb1 b.1.1.1 (B:2-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlqqsgadlvrpgasvklsctasgfdikddyvhwvkqrpeqglewigridpangatkya
pkfqdkatltadtssntaylqlssltsedtavyycgrskyfdswgqgttltvssakttpp
svyplapgcgdttgssvtlgclvkgyfpesvtvtwnsssvhtfpallqsglytmsssvtv
psstwpsqtvtcsvahpassttvdkkleps

Timeline for d5ikcb1:

• d5ikcb1 is new in SCOPe 2.08-stable