Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries) |
Domain d5fcuh_: 5fcu H: [410067] Other proteins in same PDB: d5fcul2 automated match to d6shgh_ complexed with cl, nag, so4 |
PDB Entry: 5fcu (more details), 1.85 Å
SCOPe Domain Sequences for d5fcuh_:
Sequence, based on SEQRES records: (download)
>d5fcuh_ b.1.1.0 (H:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} evqlvesgpglvkpletlsltcavpggsirrnywswirqppgkglewighsygsggstny npslesrvtlsvdtsknlfslkltsvtaadtavyycartvwyytsgthyfdhwgqgvlvt vssastkgpsvfplapssrstsestaalgclvkdyfpepvtvswnsgsltsgvhtfpavl qssglyslssvvtvpssslgtqtyvcnvnhkpsntkvdkrvei
>d5fcuh_ b.1.1.0 (H:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} evqlvesgpglvkpletlsltcavpggsirrnywswirqppgkglewighsygsggstny npslesrvtlsvdtsknlfslkltsvtaadtavyycartvwyytsgthyfdhwgqgvlvt vssastkgpsvfplapsssestaalgclvkdyfpepvtvswnsgsltsgvhtfpavlqss glyslssvvtvpsgtqtyvcnvnhkpsntkvdkrvei
Timeline for d5fcuh_: