Lineage for d5fcuh_ (5fcu H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761531Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)
  8. 2761541Domain d5fcuh_: 5fcu H: [410067]
    Other proteins in same PDB: d5fcul2
    automated match to d6shgh_
    complexed with cl, nag, so4

Details for d5fcuh_

PDB Entry: 5fcu (more details), 1.85 Å

PDB Description: crystal structure of the inner domain of clade a/e hiv-1 gp120 in complex with the adcc-potent rhesus macaque antibody jr4
PDB Compounds: (H:) jr4 fab heavy chain

SCOPe Domain Sequences for d5fcuh_:

Sequence, based on SEQRES records: (download)

>d5fcuh_ b.1.1.0 (H:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
evqlvesgpglvkpletlsltcavpggsirrnywswirqppgkglewighsygsggstny
npslesrvtlsvdtsknlfslkltsvtaadtavyycartvwyytsgthyfdhwgqgvlvt
vssastkgpsvfplapssrstsestaalgclvkdyfpepvtvswnsgsltsgvhtfpavl
qssglyslssvvtvpssslgtqtyvcnvnhkpsntkvdkrvei

Sequence, based on observed residues (ATOM records): (download)

>d5fcuh_ b.1.1.0 (H:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
evqlvesgpglvkpletlsltcavpggsirrnywswirqppgkglewighsygsggstny
npslesrvtlsvdtsknlfslkltsvtaadtavyycartvwyytsgthyfdhwgqgvlvt
vssastkgpsvfplapsssestaalgclvkdyfpepvtvswnsgsltsgvhtfpavlqss
glyslssvvtvpsgtqtyvcnvnhkpsntkvdkrvei

SCOPe Domain Coordinates for d5fcuh_:

Click to download the PDB-style file with coordinates for d5fcuh_.
(The format of our PDB-style files is described here.)

Timeline for d5fcuh_:

  • d5fcuh_ is new in SCOPe 2.08-stable