Lineage for d1bp6a_ (1bp6 A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Lactobacillus casei [TaxId:1582] [55835] (39 PDB entries) 
Domain d1bp6a_: 1bp6 A: [41000]
Details for d1bp6a_
PDB Entry: 1bp6 (more details), 2.4 Å
PDB Description: thymidylate synthase r23i, r179t double mutant
SCOP Domain Sequences for d1bp6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bp6a_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei}
mleqpyldlakkvldeghfkpdithtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrtl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav
SCOP Domain Coordinates for d1bp6a_:
Click to download the PDB-style file with coordinates for d1bp6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bp6a_:
- d1bp6a_ appears in SCOP 1.57
- d1bp6a_ appears in the current release, SCOPe 2.08
View in 3D