Lineage for d5c0nd_ (5c0n D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)
  8. 2761522Domain d5c0nd_: 5c0n D: [409846]
    Other proteins in same PDB: d5c0na_, d5c0nb_, d5c0nc_, d5c0nh_
    automated match to d6shgl_

Details for d5c0nd_

PDB Entry: 5c0n (more details), 3 Å

PDB Description: development of a monoclonal antibody targeting secreted ap2 to treat diabetes and fatty liver disease
PDB Compounds: (D:) Fab CA33 light chain

SCOPe Domain Sequences for d5c0nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c0nd_ b.1.1.0 (D:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dvvmtqtpasvsepvggtvtikcqasedisrylvwyqqkpgqppkrliykastlasgvps
rfkgsgsgtdftltisdlecddaatyycqctygtyagsffysfgggtevvvertdaaptv
sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdctysm
sstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d5c0nd_:

Click to download the PDB-style file with coordinates for d5c0nd_.
(The format of our PDB-style files is described here.)

Timeline for d5c0nd_:

  • d5c0nd_ is new in SCOPe 2.08-stable