Lineage for d1tdub_ (1tdu B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35325Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
  4. 35326Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 35327Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 35339Protein Thymidylate synthase [55833] (7 species)
  7. 35354Species Escherichia coli [TaxId:562] [55834] (39 PDB entries)
  8. 35393Domain d1tdub_: 1tdu B: [40964]

Details for d1tdub_

PDB Entry: 1tdu (more details), 2.1 Å

PDB Description: e. coli thymidylate synthase in complex with cb3717 and 2'-deoxyuridine (durd)

SCOP Domain Sequences for d1tdub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdub_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOP Domain Coordinates for d1tdub_:

Click to download the PDB-style file with coordinates for d1tdub_.
(The format of our PDB-style files is described here.)

Timeline for d1tdub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tdua_